Vergleich

Growth Hormone Releasing Factor (GHRF), ovine Europäischer Partner

ArtNr RP10737-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against other
Purity > 95%
Sequence YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 ; {TYR}{ALA}{ASP}{ALA}{ILE}{PHE}{THR}{ASN}{SER}{TYR}{ARG}{LYS}{ILE}{LEU}{GLY}{GLN}{LEU}{SER}{ALA}{ARG}{LYS}{LEU}{LEU}{GLN}{ASP}{ILE}{MET}{ASN}{ARG}{GLN}{GLN}{GLY}{GLU}{ARG}{ASN}{GLN}{GLU}{GLN}{GLY}{ALA}{LYS
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10737-Growth_Hormone_Releasing_Factor_GHRF_ovine, Preferably, the muscle specific GHRF expression system is constructed in a plasmid vector. The complementary DNA (cDNA) sequences encoding GHRF signal peptide and GHRF itself were designed from the published peptide primary structure and optimized for mammalian codon usage. This cDNA is synthesized using conventional oligonucleotide synthesis chemistry. The GHRF and its signal peptide encoded by the cDNA sequences can be the corresponding natural or recombinant or synthetic, or biologically active fragments or their analogues with similar activities. The GHRF leader sequence encodes a signal peptide in the nascent GHRF peptides that will direct the export of said GHRF peptides out of the muscle cells and secretion into the general circulation in an active form. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products Growth
Lieferbar
Country of Origin
USA
Storage Conditions
Store at -20C.
Description
Preferably, the muscle specific GHRF expression system is constructed in a plasmid vector. The complementary DNA (cDNA) sequences encoding GHRF signal peptide and GHRF itself were designed from the published peptide primary structure and optimized for mammalian codon usage. This cDNA is synthesized using conventional oligonucleotide synthesis chemistry. The GHRF and its signal peptide encoded by the cDNA sequences can be the corresponding natural or recombinant or synthetic, or biologically active fragments or their analogues with similar activities. The GHRF leader sequence encodes a signal peptide in the nascent GHRF peptides that will direct the export of said GHRF peptides out of the muscle cells and secretion into the general circulation in an active form.
C-Terminal
NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen