Comparison

Growth Hormone Releasing Factor (GHRF), ovine European Partner

Item no. RP10737-0.5
Manufacturer GenScript
Amount 0.5 mg
Category
Type Peptides
Specific against other
Purity > 95%
Sequence YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 ; {TYR}{ALA}{ASP}{ALA}{ILE}{PHE}{THR}{ASN}{SER}{TYR}{ARG}{LYS}{ILE}{LEU}{GLY}{GLN}{LEU}{SER}{ALA}{ARG}{LYS}{LEU}{LEU}{GLN}{ASP}{ILE}{MET}{ASN}{ARG}{GLN}{GLN}{GLY}{GLU}{ARG}{ASN}{GLN}{GLU}{GLN}{GLY}{ALA}{LYS
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10737-Growth_Hormone_Releasing_Factor_GHRF_ovine, Preferably, the muscle specific GHRF expression system is constructed in a plasmid vector. The complementary DNA (cDNA) sequences encoding GHRF signal peptide and GHRF itself were designed from the published peptide primary structure and optimized for mammalian codon usage. This cDNA is synthesized using conventional oligonucleotide synthesis chemistry. The GHRF and its signal peptide encoded by the cDNA sequences can be the corresponding natural or recombinant or synthetic, or biologically active fragments or their analogues with similar activities. The GHRF leader sequence encodes a signal peptide in the nascent GHRF peptides that will direct the export of said GHRF peptides out of the muscle cells and secretion into the general circulation in an active form. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products Growth
Available
Country of Origin
USA
Storage Conditions
Store at -20C.
Description
Preferably, the muscle specific GHRF expression system is constructed in a plasmid vector. The complementary DNA (cDNA) sequences encoding GHRF signal peptide and GHRF itself were designed from the published peptide primary structure and optimized for mammalian codon usage. This cDNA is synthesized using conventional oligonucleotide synthesis chemistry. The GHRF and its signal peptide encoded by the cDNA sequences can be the corresponding natural or recombinant or synthetic, or biologically active fragments or their analogues with similar activities. The GHRF leader sequence encodes a signal peptide in the nascent GHRF peptides that will direct the export of said GHRF peptides out of the muscle cells and secretion into the general circulation in an active form.
C-Terminal
NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.5 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close