« Zurück
Startseite /
Gastrin Releasing Peptide, porcine

Gastrin Releasing Peptide, porcine

ArtNr	RP10792-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology By Cell Type Carcinoma Peptides & Proteins Peptides By Organ Lung Cancer
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 ; {ALA}{PRO}{VAL}{SER}{VAL}{GLY}{GLY}{GLY}{THR}{VAL}{LEU}{ALA}{LYS}{MET}{TYR}{PRO}{ARG}{GLY}{ASN}{HIS}{TRP}{ALA}{VAL}{GLY}{HIS}{LEU}{MET}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10792-Gastrin_Releasing_Peptide_porcine_GRP, Gastrin releasing peptide (GRP) is released by the postganglionic fibres of the vagus nerve which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumour marker in the diagnosis of small-cell lung carcinoma. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store at a cool dry place. </td></tr>
Similar products	Gastrin
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed. Store at a cool dry place.
Description	Gastrin releasing peptide (GRP) is released by the postganglionic fibres of the vagus nerve which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumour marker in the diagnosis of small-cell lung carcinoma.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern