« Back
Home /
Gastrin Releasing Peptide, porcine

Gastrin Releasing Peptide, porcine

Item no.	RP10792-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology By Cell Type Carcinoma Peptides & Proteins Peptides By Organ Lung Cancer
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 ; {ALA}{PRO}{VAL}{SER}{VAL}{GLY}{GLY}{GLY}{THR}{VAL}{LEU}{ALA}{LYS}{MET}{TYR}{PRO}{ARG}{GLY}{ASN}{HIS}{TRP}{ALA}{VAL}{GLY}{HIS}{LEU}{MET}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10792-Gastrin_Releasing_Peptide_porcine_GRP, Gastrin releasing peptide (GRP) is released by the postganglionic fibres of the vagus nerve which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumour marker in the diagnosis of small-cell lung carcinoma. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store at a cool dry place. </td></tr>
Similar products	Gastrin
Available
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed. Store at a cool dry place.
Description	Gastrin releasing peptide (GRP) is released by the postganglionic fibres of the vagus nerve which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumour marker in the diagnosis of small-cell lung carcinoma.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer