« Zurück
Startseite /
Fibronectin-Binding Protein

Fibronectin-Binding Protein

ArtNr	RP10840-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology Neuroscience Neural Adhesion Molecules By Cell Type Peptides & Proteins Cell Biology Cell Movement Cell Adhesion Cell Stainings ECM Peptides
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV ; {PHE}{ASN}{LYS}{HIS}{THR}{GLU}{ILE}{ILE}{GLU}{GLU}{ASP}{THR}{ASN}{LYS}{ASP}{LYS}{PRO}{SER}{TYR}{GLN}{PHE}{GLY}{GLY}{HIS}{ASN}{SER}{VAL}{ASP}{PHE}{GLU}{GLU}{ASP}{THR}{LEU}{PRO}{LYS}{VAL}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10840-Fibronectin-Binding_Protein_FnBP_Fbp, Fibronectin-binding protein (Fbp) is known to be involved in bacterial adhesion to cell surface for colonization, and hence to be a virulence factor. The ability of bacteria to bind fibronectin is thought to enable the colonization of wound tissue and blood clots. The fibronectin-binding protein is directly involved in the fibronectin-mediated adherence of the bacteria to epithelial cells. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep the container tightly closed. Store in a cool dry place. </td></tr>
Similar products	Fibronectin-Binding
Lieferbar
Country of Origin	USA
Storage Conditions	Store the peptide at -20C. Keep the container tightly closed. Store in a cool dry place.
Description	Fibronectin-binding protein (Fbp) is known to be involved in bacterial adhesion to cell surface for colonization, and hence to be a virulence factor. The ability of bacteria to bind fibronectin is thought to enable the colonization of wound tissue and blood clots. The fibronectin-binding protein is directly involved in the fibronectin-mediated adherence of the bacteria to epithelial cells.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern