« Back
Home /
Fibronectin-Binding Protein

Fibronectin-Binding Protein

Item no.	RP10840-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Neuroscience Neural Adhesion Molecules By Cell Type Peptides & Proteins Cell Biology Cell Movement Cell Adhesion Cell Stainings ECM Peptides
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV ; {PHE}{ASN}{LYS}{HIS}{THR}{GLU}{ILE}{ILE}{GLU}{GLU}{ASP}{THR}{ASN}{LYS}{ASP}{LYS}{PRO}{SER}{TYR}{GLN}{PHE}{GLY}{GLY}{HIS}{ASN}{SER}{VAL}{ASP}{PHE}{GLU}{GLU}{ASP}{THR}{LEU}{PRO}{LYS}{VAL}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10840-Fibronectin-Binding_Protein_FnBP_Fbp, Fibronectin-binding protein (Fbp) is known to be involved in bacterial adhesion to cell surface for colonization, and hence to be a virulence factor. The ability of bacteria to bind fibronectin is thought to enable the colonization of wound tissue and blood clots. The fibronectin-binding protein is directly involved in the fibronectin-mediated adherence of the bacteria to epithelial cells. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep the container tightly closed. Store in a cool dry place. </td></tr>
Similar products	Fibronectin-Binding
Available
Country of Origin	USA
Storage Conditions	Store the peptide at -20C. Keep the container tightly closed. Store in a cool dry place.
Description	Fibronectin-binding protein (Fbp) is known to be involved in bacterial adhesion to cell surface for colonization, and hence to be a virulence factor. The ability of bacteria to bind fibronectin is thought to enable the colonization of wound tissue and blood clots. The fibronectin-binding protein is directly involved in the fibronectin-mediated adherence of the bacteria to epithelial cells.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 11/13/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer