« Zurück
Startseite /
beta-Endorphin, camel

beta-Endorphin, camel

ArtNr	RP11343
Hersteller	GenScript
Menge	1 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Peptides
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ ; {TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}{GLN}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11343-b-Endorphin_camel, Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, beta-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. beta-endorphin is released in response to painful stimuli. beta-endorphin has potent antinociceptive activity that is mediated through its action on u receptors in brain and by u and kappa receptors in the spinal cord. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is insoluble in water. Dissolve the peptide in small amount of acetonitrile and then dilute the solution with water or any other buffer. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C </td></tr>
Similar products	beta-Endorphin
Lieferbar
Country of Origin	USA
Storage Conditions	Store the peptide at -20C
Description	Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, beta-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. beta-endorphin is released in response to painful stimuli. beta-endorphin has potent antinociceptive activity that is mediated through its action on u receptors in brain and by u and kappa receptors in the spinal cord.
Solubility	The peptide is insoluble in water. Dissolve the peptide in small amount of acetonitrile and then dilute the solution with water or any other buffer.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern