« Back
Home /
beta-Endorphin, camel

beta-Endorphin, camel

Item no.	RP11343
Manufacturer	GenScript
Amount	1 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Peptides
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ ; {TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}{GLN}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11343-b-Endorphin_camel, Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, beta-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. beta-endorphin is released in response to painful stimuli. beta-endorphin has potent antinociceptive activity that is mediated through its action on u receptors in brain and by u and kappa receptors in the spinal cord. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is insoluble in water. Dissolve the peptide in small amount of acetonitrile and then dilute the solution with water or any other buffer. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C </td></tr>
Similar products	beta-Endorphin
Available
Country of Origin	USA
Storage Conditions	Store the peptide at -20C
Description	Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, beta-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. beta-endorphin is released in response to painful stimuli. beta-endorphin has potent antinociceptive activity that is mediated through its action on u receptors in brain and by u and kappa receptors in the spinal cord.
Solubility	The peptide is insoluble in water. Dissolve the peptide in small amount of acetonitrile and then dilute the solution with water or any other buffer.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer