« Zurück
Startseite /
Calmodulin Binding Peptide 1

Calmodulin Binding Peptide 1

ArtNr	RP13247
Hersteller	GenScript
Menge	0.02 mg
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Cytoskeleton Motor proteins Peptides By Organ Skin Cancer
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	GVMPREETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA ; {GLY}{VAL}{MET}{PRO}{ARG}{GLU}{GLU}{THR}{ASP}{SER}{LYS}{THR}{ALA}{SER}{PRO}{TRP}{LYS}{SER}{ALA}{ARG}{LEU}{MET}{VAL}{HIS}{THR}{VAL}{ALA}{THR}{PHE}{ASN}{SER}{ILE}{LYS}{GLU}{LEU}{ASN}{GLU}{ARG}{TRP}{ARG}{SER}{
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP13247-Calmodulin_Binding_Peptide_1, Removing endogenously bound CaM by titration with a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide) strongly inhibited IP3-induced Ca2+ release. This inhibition was concentration- and time-dependent.</td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products	Calmodulin
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed. Store in a cool dry place.
Description	Removing endogenously bound CaM by titration with a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide) strongly inhibited IP3-induced Ca2+ release. This inhibition was concentration- and time-dependent.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.