« Back
Home /
Calmodulin Binding Peptide 1

Calmodulin Binding Peptide 1

Item no.	RP13247
Manufacturer	GenScript
Amount	0.02 mg
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Cytoskeleton Motor proteins Peptides By Organ Skin Cancer
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	GVMPREETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA ; {GLY}{VAL}{MET}{PRO}{ARG}{GLU}{GLU}{THR}{ASP}{SER}{LYS}{THR}{ALA}{SER}{PRO}{TRP}{LYS}{SER}{ALA}{ARG}{LEU}{MET}{VAL}{HIS}{THR}{VAL}{ALA}{THR}{PHE}{ASN}{SER}{ILE}{LYS}{GLU}{LEU}{ASN}{GLU}{ARG}{TRP}{ARG}{SER}{
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP13247-Calmodulin_Binding_Peptide_1, Removing endogenously bound CaM by titration with a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide) strongly inhibited IP3-induced Ca2+ release. This inhibition was concentration- and time-dependent.</td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products	Calmodulin
Available
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed. Store in a cool dry place.
Description	Removing endogenously bound CaM by titration with a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide) strongly inhibited IP3-induced Ca2+ release. This inhibition was concentration- and time-dependent.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.