beta-Endorphin, equine

Hersteller GenScript
Kategorie
Typ Peptides
Specific against other
Menge 0.2mg
ArtNr RP13506
eClass 6.1 34160400
eClass 9.0 32160409
Lieferbar
Sequence (one-letter code)
YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
Sequence (three-letter code)
{TYR}{GLY}{GLY}{PHE}{MET}{SER}{SER}{GLU}{LYS}{SER}{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}{GLN}
Description
Endorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones.
Purity
> 95%
Storage
Store at -20C
Menge: 0.2mg
Lieferbar: In stock
Listenpreis: 67,16 €
Preis: 67,16 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen