« Back
Home /
beta-Endorphin, equine

beta-Endorphin, equine

Item no.	RP13506
Manufacturer	GenScript
Amount	0.2 mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ ; {TYR}{GLY}{GLY}{PHE}{MET}{SER}{SER}{GLU}{LYS}{SER}{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}{GLN}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP13506-Endorphin_Beta_Equine, Endorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr>
Similar products	beta-Endorphin
Available
Country of Origin	USA
Storage Conditions	Store at -20C
Description	Endorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.