Amylin, feline

ArtNr	RP13732
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Endocrine Regulation of Lipid Metabolism Peptides By Organ Breast Cancer Thyroid Cancer
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 ; {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{ILE}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{ALA}{ILE}{LEU}{SER}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP13732-Amylin_IAPP_Feline_DAP, Amylin is produced in the pancreas beta cells and coreleased with insulin. Amylin's amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose. </td></tr><tr><th>Solubility</th><td colspan="7"> Insoluble in water. Dissolve peptide with 10% Acetonitrile in water. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Lyophilized powder may be stored at 4C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20C. Reconstituted product is stable for 24 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. </td></tr><tr><th>Notes</th><td colspan="7"> This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.</td></tr>
Similar products	Amylin
Lieferbar
Country of Origin	USA
Storage Conditions	Lyophilized powder may be stored at 4C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20C. Reconstituted product is stable for 24 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Description	Amylin is produced in the pancreas beta cells and coreleased with insulin. Amylin's amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose.
Solubility	Insoluble in water. Dissolve peptide with 10% Acetonitrile in water.
C-Terminal	NH2
Chemical Bridge	Cys2-Cys7
Notes	This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.