« Back
Home /
Amylin, feline

Amylin, feline

Item no.	RP13732
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Endocrine Regulation of Lipid Metabolism Peptides By Organ Breast Cancer Thyroid Cancer
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 ; {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{ILE}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{ALA}{ILE}{LEU}{SER}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP13732-Amylin_IAPP_Feline_DAP, Amylin is produced in the pancreas beta cells and coreleased with insulin. Amylin's amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose. </td></tr><tr><th>Solubility</th><td colspan="7"> Insoluble in water. Dissolve peptide with 10% Acetonitrile in water. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Lyophilized powder may be stored at 4C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20C. Reconstituted product is stable for 24 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. </td></tr><tr><th>Notes</th><td colspan="7"> This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.</td></tr>
Similar products	Amylin
Available
Country of Origin	USA
Storage Conditions	Lyophilized powder may be stored at 4C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20C. Reconstituted product is stable for 24 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Description	Amylin is produced in the pancreas beta cells and coreleased with insulin. Amylin's amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose.
Solubility	Insoluble in water. Dissolve peptide with 10% Acetonitrile in water.
C-Terminal	NH2
Chemical Bridge	Cys2-Cys7
Notes	This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.