« Zurück
Startseite /
beta-Amyloid A4 Protein Precursor (740-770), APP (C31)

beta-Amyloid A4 Protein Precursor (740-770), APP (C31)

ArtNr	RP20165
Hersteller	GenScript
Menge	1 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding By Cell Type Peptides & Proteins Adenocarcinoma Cardiovascular Research Ischemia & Reperfusion Injury Peptides
Typ	Peptides
Specific against	other
Sequence	AAVTPEERHLSKMQQNGYENPTYKFFEQMQN ; {Ala}{Ala}{Val}{Thr}{Pro}{Glu}{Glu}{Arg}{His}{Leu}{Ser}{Lys}{Met}{Gln}{Gln}{Asn}{Gly}{Tyr}{Glu}{Asn}{Pro}{Thr}{Tyr}{Lys}{Phe}{Phe}{Glu}{Gln}{Met}{Gln}{Asn}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP20165-beta-Amyloid_A4_Protein_Precursor_740-770, This peptide, C31, consists of 31 amino acids and corresponds to the C-terminal fragment of the amyloid precursor protein (APP). The generation of this C31 peptide through the cleavage of APP by caspase is associated with neuronal death linked to Alzheimer’s disease. In addition, this peptide is a potent inducer of apoptosis and is located in lipid rafts together with APP-BP1, a binding protein for APP’s intracellular domain. </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products	beta-Amyloid
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed. Store in a cool dry place.
Description	This peptide, C31, consists of 31 amino acids and corresponds to the C-terminal fragment of the amyloid precursor protein (APP). The generation of this C31 peptide through the cleavage of APP by caspase is associated with neuronal death linked to Alzheimer’s disease. In addition, this peptide is a potent inducer of apoptosis and is located in lipid rafts together with APP-BP1, a binding protein for APP’s intracellular domain.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern