« Back
Home /
beta-Amyloid A4 Protein Precursor (740-770), APP (C31)

beta-Amyloid A4 Protein Precursor (740-770), APP (C31)

Item no.	RP20165
Manufacturer	GenScript
Amount	1 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding By Cell Type Peptides & Proteins Adenocarcinoma Cardiovascular Research Ischemia & Reperfusion Injury Peptides
Type	Peptides
Specific against	other
Sequence	AAVTPEERHLSKMQQNGYENPTYKFFEQMQN ; {Ala}{Ala}{Val}{Thr}{Pro}{Glu}{Glu}{Arg}{His}{Leu}{Ser}{Lys}{Met}{Gln}{Gln}{Asn}{Gly}{Tyr}{Glu}{Asn}{Pro}{Thr}{Tyr}{Lys}{Phe}{Phe}{Glu}{Gln}{Met}{Gln}{Asn}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP20165-beta-Amyloid_A4_Protein_Precursor_740-770, This peptide, C31, consists of 31 amino acids and corresponds to the C-terminal fragment of the amyloid precursor protein (APP). The generation of this C31 peptide through the cleavage of APP by caspase is associated with neuronal death linked to Alzheimer’s disease. In addition, this peptide is a potent inducer of apoptosis and is located in lipid rafts together with APP-BP1, a binding protein for APP’s intracellular domain. </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products	beta-Amyloid
Available
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed. Store in a cool dry place.
Description	This peptide, C31, consists of 31 amino acids and corresponds to the C-terminal fragment of the amyloid precursor protein (APP). The generation of this C31 peptide through the cleavage of APP by caspase is associated with neuronal death linked to Alzheimer’s disease. In addition, this peptide is a potent inducer of apoptosis and is located in lipid rafts together with APP-BP1, a binding protein for APP’s intracellular domain.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer