Vergleich

TIP 39, Tuberoinfundibular Neuropeptide Europäischer Partner

ArtNr RP20322-1
Hersteller GenScript
Menge 1 mg
Quantity options 0.5 mg 1 mg
Kategorie
Typ Peptides
Specific against other
Purity > 95%
Sequence SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP ; {Ser}{Leu}{Ala}{Leu}{Ala}{Asp}{Asp}{Ala}{Ala}{Phe}{Arg}{Glu}{Arg}{Ala}{Arg}{Leu}{Leu}{Ala}{Ala}{Leu}{Glu}{Arg}{Arg}{His}{Trp}{Leu}{Asn}{Ser}{Tyr}{Met}{His}{Lys}{Leu}{Leu}{Val}{Leu}{Asp}{Ala}{Pro}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP20322-TIP_39, This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products TIP
Lieferbar
Country of Origin
USA
Storage Conditions
Store at -20C. Keep tightly closed. Store in a cool dry place.
Description
This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen