« Zurück
Home /
Ubiquitin (1-34)

Ubiquitin (1-34)

ArtNr	RP20508
Hersteller	GenScript
Menge	1 mg
Kategorie	Neuroscience Neuroinflammation Peptides & Proteins Cell Biology Cell Status Autophagy Peptides
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE ; {Met}{Gln}{Ile}{Phe}{Val}{Lys}{Thr}{Leu}{Thr}{Gly}{Lys}{Thr}{Ile}{Thr}{Leu}{Glu}{Val}{Glu}{Pro}{Ser}{Asp}{Thr}{Ile}{Glu}{Asn}{Val}{Lys}{Ala}{Lys}{Ile}{Gln}{Asp}{Lys}{Glu}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP20508-Ubiquitin_1-34, This peptide is amino acids 1 to 34 fragment of ubiquitin. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide, is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide can be used with C-terminal-derived peptide as a effective anti-fungal agent. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. </td></tr>
Similar products	Ubiquitin
Lieferbar
Country of Origin	USA
Storage Conditions	Store the peptide at -20C.
Description	This peptide is amino acids 1 to 34 fragment of ubiquitin. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide, is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide can be used with C-terminal-derived peptide as a effective anti-fungal agent.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 17.07.2025

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern