Ubiquitin (1-34)

Hersteller GenScript
Kategorie
Typ Peptides
Specific against other
Menge 1mg
ArtNr RP20508
Eclass 6.1 34160400
Eclass 9.0 32160409
Lieferbar
Sequence (one-letter code)
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE
Sequence (three-letter code)
{Met}{Gln}{Ile}{Phe}{Val}{Lys}{Thr}{Leu}{Thr}{Gly}{Lys}{Thr}{Ile}{Thr}{Leu}{Glu}{Val}{Glu}{Pro}{Ser}{Asp}{Thr}{Ile}{Glu}{Asn}{Val}{Lys}{Ala}{Lys}{Ile}{Gln}{Asp}{Lys}{Glu}
Description
This peptide is amino acids 1 to 34 fragment of ubiquitin. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide, is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide can be used with C-terminal-derived peptide as a effective anti-fungal agent.
Purity
> 95%
Storage
Store the peptide at -20C.
Menge: 1mg
Lieferbar: Out of stock
Listenpreis: 289,18 €
Preis: 289,18 €
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Schließen