Comparison

Ubiquitin (1-34) European Partner

Item no. RP20508
Manufacturer GenScript
Amount 1 mg
Category
Type Peptides
Specific against other
Purity > 95%
Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE ; {Met}{Gln}{Ile}{Phe}{Val}{Lys}{Thr}{Leu}{Thr}{Gly}{Lys}{Thr}{Ile}{Thr}{Leu}{Glu}{Val}{Glu}{Pro}{Ser}{Asp}{Thr}{Ile}{Glu}{Asn}{Val}{Lys}{Ala}{Lys}{Ile}{Gln}{Asp}{Lys}{Glu}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP20508-Ubiquitin_1-34, This peptide is amino acids 1 to 34 fragment of ubiquitin. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide, is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide can be used with C-terminal-derived peptide as a effective anti-fungal agent. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. </td></tr>
Similar products Ubiquitin
Available
Country of Origin
USA
Storage Conditions
Store the peptide at -20C.
Description
This peptide is amino acids 1 to 34 fragment of ubiquitin. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide, is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide can be used with C-terminal-derived peptide as a effective anti-fungal agent.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Delivery expected until 10/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close