« Back
Home /
Ubiquitin (1-34)

Ubiquitin (1-34)

Item no.	RP20508
Manufacturer	GenScript
Amount	1 mg
Category	Neuroscience Neuroinflammation Peptides & Proteins Cell Biology Cell Status Autophagy Peptides
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE ; {Met}{Gln}{Ile}{Phe}{Val}{Lys}{Thr}{Leu}{Thr}{Gly}{Lys}{Thr}{Ile}{Thr}{Leu}{Glu}{Val}{Glu}{Pro}{Ser}{Asp}{Thr}{Ile}{Glu}{Asn}{Val}{Lys}{Ala}{Lys}{Ile}{Gln}{Asp}{Lys}{Glu}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP20508-Ubiquitin_1-34, This peptide is amino acids 1 to 34 fragment of ubiquitin. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide, is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide can be used with C-terminal-derived peptide as a effective anti-fungal agent. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. </td></tr>
Similar products	Ubiquitin
Available
Country of Origin	USA
Storage Conditions	Store the peptide at -20C.
Description	This peptide is amino acids 1 to 34 fragment of ubiquitin. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide, is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide can be used with C-terminal-derived peptide as a effective anti-fungal agent.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 7/17/2025