PHI (PHI-27), rat

ArtNr	RP10078-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Neuroscience Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Endocrine Regulation of Lipid Metabolism Peptides
Typ	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	HADGVFTSDYSRLLGQISAKKYLESLI-NH2 ; {HIS}{ALA}{ASP}{GLY}{VAL}{PHE}{THR}{SER}{ASP}{TYR}{SER}{ARG}{LEU}{LEU}{GLY}{GLN}{ILE}{SER}{ALA}{LYS}{LYS}{TYR}{LEU}{GLU}{SER}{LEU}{ILE}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10078-PHI_PHI-27_rat, PHI increased the release of insulin, glucagon, and somatostatin. In the absence of glucose, PHI stimulated glucagon release. PHI take part in the regulation of the function of the pancreatic A, B, and D cells. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at 20C. </td></tr>
Similar products	PHI
Lieferbar
Country of Origin	USA
Storage Conditions	Store at 20C.
Description	PHI increased the release of insulin, glucagon, and somatostatin. In the absence of glucose, PHI stimulated glucagon release. PHI take part in the regulation of the function of the pancreatic A, B, and D cells.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern