« Back
Home /
PHI (PHI-27), rat

PHI (PHI-27), rat

Item no.	RP10078-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Neuroscience Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Endocrine Regulation of Lipid Metabolism Peptides
Type	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	HADGVFTSDYSRLLGQISAKKYLESLI-NH2 ; {HIS}{ALA}{ASP}{GLY}{VAL}{PHE}{THR}{SER}{ASP}{TYR}{SER}{ARG}{LEU}{LEU}{GLY}{GLN}{ILE}{SER}{ALA}{LYS}{LYS}{TYR}{LEU}{GLU}{SER}{LEU}{ILE}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10078-PHI_PHI-27_rat, PHI increased the release of insulin, glucagon, and somatostatin. In the absence of glucose, PHI stimulated glucagon release. PHI take part in the regulation of the function of the pancreatic A, B, and D cells. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at 20C. </td></tr>
Similar products	PHI
Available
Country of Origin	USA
Storage Conditions	Store at 20C.
Description	PHI increased the release of insulin, glucagon, and somatostatin. In the absence of glucose, PHI stimulated glucagon release. PHI take part in the regulation of the function of the pancreatic A, B, and D cells.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer