Vergleich

PACAP (6-38), human, ovine, rat Europäischer Partner

ArtNr RP10338-5
Hersteller GenScript
Menge 5.0 mg
Quantity options 0.5 mg 5.0 mg
Kategorie
Typ Peptides
Specific against Rat (Rattus norvegicus)
Purity > 95%
Sequence FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 ; {PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{VAL}{LYS}{ASN}{LYS}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10338-PACAP_6-38, PACAP (6-38) is a potent antagonist of PACAP 38. PACAP (6-38) is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27-stimulated pituitary adenylate cyclase. Ki values for the inhibition of the enzyme were 7nM and 150 nM, respectively. PACAP (6-38) caused a small but significant (approximately 20%) inhibition of the NANC relaxation due to electrical field stimulation (1 Hz or 10 Hz for 20 s). At these frequencies PACAP (6-38) caused no inhibition of the NANC relaxation in the presence of the P2 purinoceptor antagonist pyridoxal-phosphate-6-azophenyl-2',4'-disulphonic acid (or PPADS) plus the NO-synthase blocker NG-nitro-L-arginine, in preparations pretreated with L-NOARG alone, PACAP (6-38) retained its inhibitory effect. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. </td></tr><tr><th>Notes</th><td colspan="7"> This peptide is a potent agonist.</td></tr>
Similar products PACAP
Lieferbar
Country of Origin
USA
Storage Conditions
Store the peptide at -20C.
Description
PACAP (6-38) is a potent antagonist of PACAP 38. PACAP (6-38) is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27-stimulated pituitary adenylate cyclase. Ki values for the inhibition of the enzyme were 7nM and 150 nM, respectively. PACAP (6-38) caused a small but significant (approximately 20%) inhibition of the NANC relaxation due to electrical field stimulation (1 Hz or 10 Hz for 20 s). At these frequencies PACAP (6-38) caused no inhibition of the NANC relaxation in the presence of the P2 purinoceptor antagonist pyridoxal-phosphate-6-azophenyl-2', 4'-disulphonic acid (or PPADS) plus the NO-synthase blocker NG-nitro-L-arginine, in preparations pretreated with L-NOARG alone, PACAP (6-38) retained its inhibitory effect.
Solubility
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
C-Terminal
NH2
Notes
This peptide is a potent agonist.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5.0 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen