« Zurück
Startseite /
Growth Hormone Releasing Factor (GHRF), rat

Growth Hormone Releasing Factor (GHRF), rat

ArtNr	RP10739-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Peptides & Proteins Peptides
Typ	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN ; {HIS}{ALA}{ASP}{ALA}{ILE}{PHE}{THR}{SER}{SER}{TYR}{ARG}{ARG}{ILE}{LEU}{GLY}{GLN}{LEU}{TYR}{ALA}{ARG}{LYS}{LEU}{LEU}{HIS}{GLU}{ILE}{MET}{ASN}{ARG}{GLN}{GLN}{GLY}{GLU}{ARG}{ASN}{GLN}{GLU}{GLN}{ARG}{SER}{ARG}{PHE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10739-Growth_Hormone_Releasing_Factor_GHRF_rat, Rat GHRF caused calcium- and dose-dependent stimulation of SRIF release in static 1-h incubations. SRIF release was stimulated by GHRF in a concentration range of 1-100 nM. However, the extended dose-response curve was biphasic in nature, with a significantly lower SRIF response in the presence of 1 uM GHRF vs. 100 nM GHRF. SRIF release, stimulated by another secretagogue (10 uM veratridine), was not affected by the presence or absence of 1 uM GHRF, suggesting the lack of toxic impairment of hypothalamic cell function by GHRF at this concentration. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at 20C. </td></tr>
Similar products	Growth
Lieferbar
Country of Origin	USA
Storage Conditions	Store at 20C.
Description	Rat GHRF caused calcium- and dose-dependent stimulation of SRIF release in static 1-h incubations. SRIF release was stimulated by GHRF in a concentration range of 1-100 nM. However, the extended dose-response curve was biphasic in nature, with a significantly lower SRIF response in the presence of 1 uM GHRF vs. 100 nM GHRF. SRIF release, stimulated by another secretagogue (10 uM veratridine), was not affected by the presence or absence of 1 uM GHRF, suggesting the lack of toxic impairment of hypothalamic cell function by GHRF at this concentration.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern