« Back
Home /
Growth Hormone Releasing Factor (GHRF), rat

Growth Hormone Releasing Factor (GHRF), rat

Item no.	RP10739-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Peptides & Proteins Peptides
Type	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN ; {HIS}{ALA}{ASP}{ALA}{ILE}{PHE}{THR}{SER}{SER}{TYR}{ARG}{ARG}{ILE}{LEU}{GLY}{GLN}{LEU}{TYR}{ALA}{ARG}{LYS}{LEU}{LEU}{HIS}{GLU}{ILE}{MET}{ASN}{ARG}{GLN}{GLN}{GLY}{GLU}{ARG}{ASN}{GLN}{GLU}{GLN}{ARG}{SER}{ARG}{PHE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10739-Growth_Hormone_Releasing_Factor_GHRF_rat, Rat GHRF caused calcium- and dose-dependent stimulation of SRIF release in static 1-h incubations. SRIF release was stimulated by GHRF in a concentration range of 1-100 nM. However, the extended dose-response curve was biphasic in nature, with a significantly lower SRIF response in the presence of 1 uM GHRF vs. 100 nM GHRF. SRIF release, stimulated by another secretagogue (10 uM veratridine), was not affected by the presence or absence of 1 uM GHRF, suggesting the lack of toxic impairment of hypothalamic cell function by GHRF at this concentration. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at 20C. </td></tr>
Similar products	Growth
Available
Country of Origin	USA
Storage Conditions	Store at 20C.
Description	Rat GHRF caused calcium- and dose-dependent stimulation of SRIF release in static 1-h incubations. SRIF release was stimulated by GHRF in a concentration range of 1-100 nM. However, the extended dose-response curve was biphasic in nature, with a significantly lower SRIF response in the presence of 1 uM GHRF vs. 100 nM GHRF. SRIF release, stimulated by another secretagogue (10 uM veratridine), was not affected by the presence or absence of 1 uM GHRF, suggesting the lack of toxic impairment of hypothalamic cell function by GHRF at this concentration.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer