Vergleich

Glucagon-Like Peptide (GLP) II, rat Europäischer Partner

ArtNr RP10775-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against Rat (Rattus norvegicus)
Purity > 95%
Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD ; {HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{THR}{ARG}{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}{ILE}{THR}{ASP}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10775-Glucagon-Like_Peptide_II_GLP-2_rat, GLP-2 is related in sequence to GLP-1, glucagon, GIP and other members of the glucagon peptide superfamily. Many of these peptides exhibit an alanine at position 2, rendering them ideal substrates for degradation by the enzyme DP IV. Indeed, Analysis of circulating forms of GLP-2 in rodents and humans confirms that both GLP-21-33 and GLP-23-33 are detected in the fasting and postprandial states. Consistent with the importance of DP IV for GLP-2 bioactivity and degradation, a relatively larger amount of GLP-2 is required to stimulate GLP-2-dependent endpoints in rats compared to mice, as the former exhibit comparatively greater levels of circulating DP IV activity. Accordingly, analogues of GLP-2 that are resistant to DP IV-mediated degradation are more potent than the native peptide in vivo. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr>
Similar products Glucagon-Like
Lieferbar
Country of Origin
USA
Storage Conditions
Store at -20C
Description
GLP-2 is related in sequence to GLP-1, glucagon, GIP and other members of the glucagon peptide superfamily. Many of these peptides exhibit an alanine at position 2, rendering them ideal substrates for degradation by the enzyme DP IV. Indeed, Analysis of circulating forms of GLP-2 in rodents and humans confirms that both GLP-21-33 and GLP-23-33 are detected in the fasting and postprandial states. Consistent with the importance of DP IV for GLP-2 bioactivity and degradation, a relatively larger amount of GLP-2 is required to stimulate GLP-2-dependent endpoints in rats compared to mice, as the former exhibit comparatively greater levels of circulating DP IV activity. Accordingly, analogues of GLP-2 that are resistant to DP IV-mediated degradation are more potent than the native peptide in vivo.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen