Comparison

Glucagon-Like Peptide (GLP) II, rat European Partner

Item no. RP10775-0.5
Manufacturer GenScript
Amount 0.5 mg
Category
Type Peptides
Specific against Rat (Rattus norvegicus)
Purity > 95%
Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD ; {HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{THR}{ARG}{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}{ILE}{THR}{ASP}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10775-Glucagon-Like_Peptide_II_GLP-2_rat, GLP-2 is related in sequence to GLP-1, glucagon, GIP and other members of the glucagon peptide superfamily. Many of these peptides exhibit an alanine at position 2, rendering them ideal substrates for degradation by the enzyme DP IV. Indeed, Analysis of circulating forms of GLP-2 in rodents and humans confirms that both GLP-21-33 and GLP-23-33 are detected in the fasting and postprandial states. Consistent with the importance of DP IV for GLP-2 bioactivity and degradation, a relatively larger amount of GLP-2 is required to stimulate GLP-2-dependent endpoints in rats compared to mice, as the former exhibit comparatively greater levels of circulating DP IV activity. Accordingly, analogues of GLP-2 that are resistant to DP IV-mediated degradation are more potent than the native peptide in vivo. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr>
Similar products Glucagon-Like
Available
Country of Origin
USA
Storage Conditions
Store at -20C
Description
GLP-2 is related in sequence to GLP-1, glucagon, GIP and other members of the glucagon peptide superfamily. Many of these peptides exhibit an alanine at position 2, rendering them ideal substrates for degradation by the enzyme DP IV. Indeed, Analysis of circulating forms of GLP-2 in rodents and humans confirms that both GLP-21-33 and GLP-23-33 are detected in the fasting and postprandial states. Consistent with the importance of DP IV for GLP-2 bioactivity and degradation, a relatively larger amount of GLP-2 is required to stimulate GLP-2-dependent endpoints in rats compared to mice, as the former exhibit comparatively greater levels of circulating DP IV activity. Accordingly, analogues of GLP-2 that are resistant to DP IV-mediated degradation are more potent than the native peptide in vivo.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.5 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close