Vergleich

Calcitonin, rat Europäischer Partner

ArtNr RP11098-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against Rat (Rattus norvegicus)
Purity > 95%
Sequence CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 ; {CYS}{GLY}{ASN}{LEU}{SER}{THR}{CYS}{MET}{LEU}{GLY}{THR}{TYR}{THR}{GLN}{ASP}{LEU}{ASN}{LYS}{PHE}{HIS}{THR}{PHE}{PRO}{GLN}{THR}{SER}{ILE}{GLY}{VAL}{GLY}{ALA}{PRO}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP11098-Calcitonin_rat, Calcitonin (rat) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr><tr><th>Notes</th><td colspan="7"> Calcitonin (rat)is a 32 amino acid polypeptide, 8 of which are conserved across all species.</td></tr>
Similar products Calcitonin
Lieferbar
Country of Origin
USA
Storage Conditions
Store at -20C.
Description
Calcitonin (rat) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Solubility
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal
NH2
Chemical Bridge
Disulfide bridge: Cys1-Cys7
Notes
Calcitonin (rat)is a 32 amino acid polypeptide, 8 of which are conserved across all species.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
Zuletzt angesehen
 
Schließen