Calcitonin, rat

ArtNr	RP11098-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Peptides By Organ Thyroid Cancer
Typ	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 ; {CYS}{GLY}{ASN}{LEU}{SER}{THR}{CYS}{MET}{LEU}{GLY}{THR}{TYR}{THR}{GLN}{ASP}{LEU}{ASN}{LYS}{PHE}{HIS}{THR}{PHE}{PRO}{GLN}{THR}{SER}{ILE}{GLY}{VAL}{GLY}{ALA}{PRO}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11098-Calcitonin_rat, Calcitonin (rat) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr><tr><th>Notes</th><td colspan="7"> Calcitonin (rat)is a 32 amino acid polypeptide, 8 of which are conserved across all species.</td></tr>
Similar products	Calcitonin
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	Calcitonin (rat) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2
Chemical Bridge	Disulfide bridge: Cys1-Cys7
Notes	Calcitonin (rat)is a 32 amino acid polypeptide, 8 of which are conserved across all species.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern