« Back
Home /
Calcitonin, rat

Calcitonin, rat

Item no.	RP11098-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Peptides By Organ Thyroid Cancer
Type	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 ; {CYS}{GLY}{ASN}{LEU}{SER}{THR}{CYS}{MET}{LEU}{GLY}{THR}{TYR}{THR}{GLN}{ASP}{LEU}{ASN}{LYS}{PHE}{HIS}{THR}{PHE}{PRO}{GLN}{THR}{SER}{ILE}{GLY}{VAL}{GLY}{ALA}{PRO}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11098-Calcitonin_rat, Calcitonin (rat) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr><tr><th>Notes</th><td colspan="7"> Calcitonin (rat)is a 32 amino acid polypeptide, 8 of which are conserved across all species.</td></tr>
Similar products	Calcitonin
Available
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	Calcitonin (rat) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2
Chemical Bridge	Disulfide bridge: Cys1-Cys7
Notes	Calcitonin (rat)is a 32 amino acid polypeptide, 8 of which are conserved across all species.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 11/13/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer