Vergleich

Amylin, amide, rat Europäischer Partner

ArtNr RP11280-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against Rat (Rattus norvegicus)
Purity > 95%
Sequence KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 ; {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{PRO}{VAL}{LEU}{PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP11280-Amylin_Diabetes_Associated_Peptide_DAP_IAPP_rat, Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP), Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach, amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments, amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion.</td></tr><tr><th>Solubility</th><td colspan="7"> Can be dissolved in water directly </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products Amylin
Lieferbar
Country of Origin
USA
Storage Conditions
Store at -20C.
Description
Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP), Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach, amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments, amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion.
Solubility
Can be dissolved in water directly
C-Terminal
NH2
Chemical Bridge
Disulfide bridge: Cys2-Cys7

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen