« Back
Home /
Amylin, amide, rat

Amylin, amide, rat

Item no.	RP11280-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Food Safety Histamines Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Cell Biology Cell Status Necrosis Peptides By Organ Breast Cancer Thyroid Cancer
Type	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 ; {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{PRO}{VAL}{LEU}{PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11280-Amylin_Diabetes_Associated_Peptide_DAP_IAPP_rat, Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP), Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach, amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments, amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion.</td></tr><tr><th>Solubility</th><td colspan="7"> Can be dissolved in water directly </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products	Amylin
Available
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP), Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach, amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments, amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion.
Solubility	Can be dissolved in water directly
C-Terminal	NH2
Chemical Bridge	Disulfide bridge: Cys2-Cys7

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer