Vergleich

sCD40L, Human Europäischer Partner

ArtNr Z02727-1
Hersteller GenScript
Menge 1 mg
Quantity options 1 mg 50 ug
Kategorie
Typ Proteins
Format Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against Human (Homo sapiens)
Purity >95% by SDS-PAGE and HPLC analyses.
Sequence MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNL VTLENGKQLT VKRQGLYYIY AQVTFCSNRE ASSQAPFIAS LWLKSPGRFE RILLRAANTH SSAKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02727-soluble_CD40_Ligand_sCD40L_Human, CD40 ligand, CD40L (also known as CD154, TRAP or gp39), is a 261 amino acid type II transmembrane glycoprotein belonging to the TNF family, CD40L is expressed predominantly on activated CD4+ T lymphocytes, and also found in other types of cells, like NK cells, mast cells, basophils and eosinophils. Human CD40L shares 78% amino acid identity with its mouse counterpart. The receptor of CD40L is CD40, a type I transmembrane glycoprotein belonging to the TNF receptor family. CD40 is expressed on B lymphocytes, monocytes, dendritic cells and thymic epithelium. Although all monomeric, dimeric and trimeric forms of soluble CD40L can bind to CD40, the trimeric form of soluble CD40L has the most potent biological activity through oligomerization of cell surface CD40, a common feature of TNF receptor family members. CD40L mediates a range of activities on B cells including induction of activation-associated surface antigen, entry into cell cycle, isotype switching and Ig secretion and memory generation. CD40-CD40L interaction also plays important roles in monocyte activation and dendritic cell maturation.</td></tr><tr><th>M.W.</th><td colspan="7"> Approximately 16.3 kDa. a single non-glycosylated polypeptide chain containing 149 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >95% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHusCD40L as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using B cell-enriched peripheral blood mononuclear cells (PBMC) is less than 3000 ng/ml, corresponding to a specific activity of 3.3 × 102 IU/mg in the presence of 20ng/ml rHuIL4.</td></tr><tr><th>Storage</th><td colspan="7"> This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.</td></tr><tr><th>Formulation</th><td colspan="7"> Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.0.</td></tr><tr><th>Reconstitution</th><td colspan="7"> We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 C. Further dilutions should be made in appropriate buffered solutions.</td></tr><tr><th>Physical Appearance</th><td colspan="7"> Sterile Filtered White lyophilized (freeze-dried) powder.</td></tr><tr><th>Usage</th><td colspan="7"> This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.</td></tr><tr><th>Sequence</th><td colspan="7"> MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNL VTLENGKQLT VKRQGLYYIY AQVTFCSNRE ASSQAPFIAS LWLKSPGRFE RILLRAANTH SSAKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL</td></tr>
Similar products soluble
Versandbedingung Gekühlt
Lieferbar
Specificity Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using B cell-enriched peripheral blood mononuclear cells (PBMC) is less than 3000 ng/ml, corresponding to a specific activity of 3.3 x 102 IU/mg in the
Manufacturer - Category
Proteins
Country of Origin
USA
Shipping Temperature
4°C
Storage Conditions
-80°C
Molecular Weight
Approximately 16.3 kDa. a single non-glycosylated polypeptide chain containing 149 amino acids.
Product Line
Cytokines
Manufacturer - Specificity
Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using B cell-enriched peripheral blood mononuclear cells (PBMC) is less than 3000 ng/ml, corresponding to a specific activity of 3.3 x 102 IU/mg in the presence of 20ng/ml rHuIL4.
Description
CD40 ligand, CD40L (also known as CD154, TRAP or gp39), is a 261 amino acid type II transmembrane glycoprotein belonging to the TNF family, CD40L is expressed predominantly on activated CD4+ T lymphocytes, and also found in other types of cells, like NK cells, mast cells, basophils and eosinophils. Human CD40L shares 78% amino acid identity with its mouse counterpart. The receptor of CD40L is CD40, a type I transmembrane glycoprotein belonging to the TNF receptor family. CD40 is expressed on B lymphocytes, monocytes, dendritic cells and thymic epithelium. Although all monomeric, dimeric and trimeric forms of soluble CD40L can bind to CD40, the trimeric form of soluble CD40L has the most potent biological activity through oligomerization of cell surface CD40, a common feature of TNF receptor family members. CD40L mediates a range of activities on B cells including induction of activation-associated surface antigen, entry into cell cycle, isotype switching and Ig secretion and memory generation. CD40-CD40L interaction also plays important roles in monocyte activation and dendritic cell maturation.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.0.
Endotoxin Level
Less than 0.2EU/ug of rHusCD40L as determined by LAL method.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen