Vergleich

MIG/CXCL9, Human Europäischer Partner

ArtNr Z02822-20
Hersteller GenScript
Menge 20 ug
Quantity options 1 mg 20 ug
Kategorie
Typ Proteins
Format Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against Human (Homo sapiens)
Purity >97% by SDS-PAGE and HPLC analyses.
Sequence TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02822-MIG_CXCL9_Human, CXCL9, a member of the ª subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN-I³. CXCL9 has been shown to be a chemoattractant for activated T-lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy-terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has recently been cloned and shown to be highly expressed in IL-2-activated T-lymphocytes.</td></tr><tr><th>M.W.</th><td colspan="7"> 11.7 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuMIG/CXCL9 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of &
Similar products MIG/CXCL9
Versandbedingung Gekühlt
Lieferbar
Specificity Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of >, 1.0 x 104 IU/mg.
Manufacturer - Category
Proteins
Country of Origin
USA
Shipping Temperature
4°C
Storage Conditions
-80°C
Molecular Weight
11.7 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids.
Product Line
Chemokines
Manufacturer - Specificity
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of >, 1.0 x 104 IU/mg.
Description
CXCL9, a member of the ª subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN-I³. CXCL9 has been shown to be a chemoattractant for activated T-lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy-terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has recently been cloned and shown to be highly expressed in IL-2-activated T-lymphocytes.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2µ, m filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Endotoxin Level
Less than 0.2EU/ug of rHuMIG/CXCL9 as determined by LAL method.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen