Vergleich

Lymphotactin/XCL1, Human Europäischer Partner

ArtNr Z02827-20
Hersteller GenScript
Menge 20 ug
Quantity options 1 mg (2x500 ug) 20 ug
Kategorie
Typ Proteins
Format Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against Human (Homo sapiens)
Purity >97% by SDS-PAGE and HPLC analyses.
Sequence GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02827-Lymphotactin_XCL1_Human, Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.</td></tr><tr><th>M.W.</th><td colspan="7"> 10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuCXCL13 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of &
Similar products Lymphotactin/XCL1
Lieferbar
Specificity Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of >, 1.0 x 104 IU/mg.
Country of Origin
USA
Storage Conditions
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Molecular Weight
10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.
Product Line
Cytokine, Chemokines & Growth Factors
Manufacturer - Specificity
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of >, 1.0 x 104 IU/mg.
Description
Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2µ, m filtered concentrated, solution in 20mM PB, pH7.4, 150mM NaCl.
Endotoxin Level
Less than 0.2EU/ug of rHuCXCL13 as determined by LAL method.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen