Flt-3 Ligand(Flt-3L), Rhesus Macaque

Hersteller GenScript
Kategorie
Typ Proteins
Specific against other
Menge 10ug 
ArtNr Z02762-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Lieferbar
Product Line
Cytokine, Chemokines & Growth Factors
Description
Flt-3 ligand (FL) is a recently identified hematopoietic cytokine whose activities are mediated by binding to the transmembrane glycoprotein Flt-3. Flt-3 was first discovered as a member of the class III subfamily of receptor tyrosine kinases (RTK) whose expression among hematopoietic cells was found to be restricted to highly enriched stem/progenitor cell populations. Additional class III RTKs include the receptors from SCF, M-CSF and PDGF. Not surprisingly, Flt-3 ligand is also structurally related to M-CSF and SCF. All three cytokines have been shown to exist both as type I transmembrane proteins and as soluble proteins.
M.W.
Approximately 18.0 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids.
Purity
>97% by SDS-PAGE and HPLC analyses.
Endotoxin Level
Less than 0.2EU/ug of rRhFlt-3L as determined by LAL method.
Specific Activity
The ED50 as calculated by the dose-dependent stimulation of the proliferation of human AML5 cells is less than 1.0 ng/ml, corresponding to a Specific Activity of 1.0x105 IU/mg
Storage
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Formulation
Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage
This material is offered by Shanghai PrimeGene for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPRSPGALEATALTAPQRP
Menge: 10ug 
Lieferbar: In stock
Listenpreis: 224,88 €
Preis: 224,88 €
lieferbar

Angebot anfordern

Fragen zum Produkt?

Ihr Ansprechpartner:

Arne Pelz

sales@hoelzel.de

Schließen