Vergleich

PCK1 (phosphoenolpyruvate carboxykinase 1 (soluble))

ArtNr 18-003-42292
Hersteller GENWAY
Menge 0.1 mg
Kategorie
Typ Antibody
Applikationen WB
Specific against other
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias GWB-F9A33D
Similar products 18-003-42292
Lieferbar
Genway ID:
GWB-F9A33D
Antigen Specificity:
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human PCK1.
Immunogen:
NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
Appearance:
Lyophilized powderWB: Antibody
Dilution:
0. 6ug/ml
ELISA Titre:
1:62500
Handling:
Add 50ul of distilled water to this antibody before use.
Note:
Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene. along with GTP. catalyzes the formation of phosphoenolpyruvate from oxaloacetate. with the release of carbon dioxide and GDP. The expression of
Catalytic Activity:
GTP + oxaloacetate = GDP + phosphoenolpyruvate + CO2.
Enzyme Regulation:
Activity is affected by a number of hormones regulating this metabolic process (such as glucagon insulin or glucocorticoids).
Pathway:
Carbohydrate biosynthesis; gluconeogenesis.
Subcellular Location:
Cytoplasm.
Tissue Specificity:
Major sites of expression are liver kidney and adipocytes.
Disease:
Defects in PCK1 are the cause of cytosolic phosphoenolpyruvate carboxykinase deficiency (cytosolic PEPCK deficiency) [MIM:261680]. PEPCK deficiency is a metabolic disorder resulting from impaired gluconeogenesis. It is a rare disease with less than 10 cases reported in the literature. Clinical characteristics include hypotonia hepatomegaly failure to thrive lactic acidosis and hypoglycaemia. Autoposy reveals fatty infiltration of both the liver and kidneys. The disorder is transmitted as an autosomal recessive trait.
Miscellaneous:
In eukaryotes there are two isozymes: a cytoplasmic one and a mitochondrial one.
Similarity:
Belongs to the phosphoenolpyruvate carboxykinase [GTP] family. Summary: This protein is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene along with GTP catalyzes the formation of phosphoenolpyruvate from oxaloacetate with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin glucocorticoids glucagon cAMP and diet. A mitochondrial isozyme of the encoded protein also has been characterized. Hajarnis. S. . et al. . (2005) J Biol Chem. 280(31). 28272-80.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen