Comparison

PCK1 (phosphoenolpyruvate carboxykinase 1 (soluble))

Item no. 18-003-42292
Manufacturer GENWAY
Amount 0.1 mg
Category
Type Antibody
Applications WB
Specific against other
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias GWB-F9A33D
Similar products 18-003-42292
Available
Genway ID:
GWB-F9A33D
Antigen Specificity:
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human PCK1.
Immunogen:
NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
Appearance:
Lyophilized powderWB: Antibody
Dilution:
0. 6ug/ml
ELISA Titre:
1:62500
Handling:
Add 50ul of distilled water to this antibody before use.
Note:
Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene. along with GTP. catalyzes the formation of phosphoenolpyruvate from oxaloacetate. with the release of carbon dioxide and GDP. The expression of
Catalytic Activity:
GTP + oxaloacetate = GDP + phosphoenolpyruvate + CO2.
Enzyme Regulation:
Activity is affected by a number of hormones regulating this metabolic process (such as glucagon insulin or glucocorticoids).
Pathway:
Carbohydrate biosynthesis; gluconeogenesis.
Subcellular Location:
Cytoplasm.
Tissue Specificity:
Major sites of expression are liver kidney and adipocytes.
Disease:
Defects in PCK1 are the cause of cytosolic phosphoenolpyruvate carboxykinase deficiency (cytosolic PEPCK deficiency) [MIM:261680]. PEPCK deficiency is a metabolic disorder resulting from impaired gluconeogenesis. It is a rare disease with less than 10 cases reported in the literature. Clinical characteristics include hypotonia hepatomegaly failure to thrive lactic acidosis and hypoglycaemia. Autoposy reveals fatty infiltration of both the liver and kidneys. The disorder is transmitted as an autosomal recessive trait.
Miscellaneous:
In eukaryotes there are two isozymes: a cytoplasmic one and a mitochondrial one.
Similarity:
Belongs to the phosphoenolpyruvate carboxykinase [GTP] family. Summary: This protein is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene along with GTP catalyzes the formation of phosphoenolpyruvate from oxaloacetate with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin glucocorticoids glucagon cAMP and diet. A mitochondrial isozyme of the encoded protein also has been characterized. Hajarnis. S. . et al. . (2005) J Biol Chem. 280(31). 28272-80.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.1 mg
Available: In stock
available

Delivery expected until 10/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close