A630025C20RIK

ArtNr	18-003-44018
Hersteller	GENWAY
Menge	0.05 mg
Kategorie	Oncology Antibodies Western Blot Primary Antibodies By Organ Breast Cancer
Typ	Antibody
Applikationen	WB
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-86240E
Similar products	18-003-44018
Lieferbar
Genway ID:	GWB-86240E
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Mouse A630025C20Rik. Western Blot: Antibody
Dilution:	0. 5ug/ml.
Handling:	Add 50ul of distilled water to this antibody before use.
Immunogen:	QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK
Appearance:	Lyoohilized powder.
ELISA Titre:	1:62500
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project. a systematic approach to determining the full coding potential of the mouse genome. involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Function:	Repressor of ligand-dependent transcription activation by various nuclear repressors. Repressor of ligand-dependent transcription activation by ESR1 ESR2 NR3C1 PGR RARA RARB RARG RXRA and VDR (By similarity). May act as transcription activator that binds DNA elements with the sequence 5' -CCCTATCGATCGATCTCTACCT-3' .
Subunit:	Interacts with ESR1 and ESR2 in the presence of estradiol. Interacts with CTBP1 HDAC3 and HDAC6. Component of a large corepressor complex that contains about 20 proteins including CTBP1 CTBP2 HDAC1 and HDAC2 (By similarity).
Subcellular Location:	Nucleus (By similarity).
Tissue Specificity:	Detected in heart and kidney.
Similarity:	Contains 1 HTH psq-type DNA-binding domain. Kunieda. T. . et al. . (2003) FEBS Lett. 535 (1-3). 61-65. Product Protocol: To see this product used in a peer reviewed journal click the following link:Ligand-dependent Corepressor LCoR Is an Attenuator of Progesterone-regulated Gene Expression

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.05 mg

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern