« Back
Home /
A630025C20RIK

A630025C20RIK

Item no.	18-003-44018
Manufacturer	GENWAY
Amount	0.05 mg
Category	Oncology Antibodies Western Blot Primary Antibodies By Organ Breast Cancer
Type	Antibody
Applications	WB
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-86240E
Similar products	18-003-44018
Available
Genway ID:	GWB-86240E
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Mouse A630025C20Rik. Western Blot: Antibody
Dilution:	0. 5ug/ml.
Handling:	Add 50ul of distilled water to this antibody before use.
Immunogen:	QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK
Appearance:	Lyoohilized powder.
ELISA Titre:	1:62500
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project. a systematic approach to determining the full coding potential of the mouse genome. involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Function:	Repressor of ligand-dependent transcription activation by various nuclear repressors. Repressor of ligand-dependent transcription activation by ESR1 ESR2 NR3C1 PGR RARA RARB RARG RXRA and VDR (By similarity). May act as transcription activator that binds DNA elements with the sequence 5' -CCCTATCGATCGATCTCTACCT-3' .
Subunit:	Interacts with ESR1 and ESR2 in the presence of estradiol. Interacts with CTBP1 HDAC3 and HDAC6. Component of a large corepressor complex that contains about 20 proteins including CTBP1 CTBP2 HDAC1 and HDAC2 (By similarity).
Subcellular Location:	Nucleus (By similarity).
Tissue Specificity:	Detected in heart and kidney.
Similarity:	Contains 1 HTH psq-type DNA-binding domain. Kunieda. T. . et al. . (2003) FEBS Lett. 535 (1-3). 61-65. Product Protocol: To see this product used in a peer reviewed journal click the following link:Ligand-dependent Corepressor LCoR Is an Attenuator of Progesterone-regulated Gene Expression

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 11/27/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer