« Zurück
Startseite /
PRPS2 (phosphoribosyl pyrophosphate synthetase 2)

PRPS2 (phosphoribosyl pyrophosphate synthetase 2)

ArtNr	18-003-44730
Hersteller	GENWAY
Menge	0.05 mg
Kategorie	Metabolism Cholesterol & Lipid Metabolism Infectious Diseases Viral Infections Coronavirus (COVID-19) Antibodies Immunohistochemistry Western Blot Primary Antibodies
Typ	Antibody
Applikationen	WB, IHC
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-D68383
Similar products	18-003-44730
Lieferbar
Genway ID:	GWB-D68383
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human PRPS2.
Appearance:	Lyophilized powderWB: Antibody
Dilution:	0. 25ug/ml
Handling:	Add 50ul of distilled water to this antibody before use. IHC: 4-8ug/ml
Immunogen:	VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI
ELISA Titre:	1:312500
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. The function remains unknown.
Catalytic Activity:	ATP + D-ribose 5-phosphate = AMP + 5-phospho-alpha-D-ribose 1-diphosphate. Cofactor: Magnesium.
Enzyme Regulation:	Activated by magnesium and inorganic phosphate. Competitively or non-competitively inhibited by ADP 2 3-bisphosphoglyceride or GDP.
Pathway:	Metabolic intermediate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate from D-ribose 5-phosphate (route I): step 1/1.
Similarity:	Belongs to the ribose-phosphate pyrophosphokinase family. Ishijima. S. . (1997) Biochim. Biophys. Acta 1342 (1). 28-36.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.05 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern