« Back
Home /
PRPS2 (phosphoribosyl pyrophosphate synthetase 2)

PRPS2 (phosphoribosyl pyrophosphate synthetase 2)

Item no.	18-003-44730
Manufacturer	GENWAY
Amount	0.05 mg
Category	Metabolism Cholesterol & Lipid Metabolism Infectious Diseases Viral Infections Coronavirus (COVID-19) Antibodies Immunohistochemistry Western Blot Primary Antibodies
Type	Antibody
Applications	WB, IHC
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-D68383
Similar products	18-003-44730
Available
Genway ID:	GWB-D68383
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human PRPS2.
Appearance:	Lyophilized powderWB: Antibody
Dilution:	0. 25ug/ml
Handling:	Add 50ul of distilled water to this antibody before use. IHC: 4-8ug/ml
Immunogen:	VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI
ELISA Titre:	1:312500
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. The function remains unknown.
Catalytic Activity:	ATP + D-ribose 5-phosphate = AMP + 5-phospho-alpha-D-ribose 1-diphosphate. Cofactor: Magnesium.
Enzyme Regulation:	Activated by magnesium and inorganic phosphate. Competitively or non-competitively inhibited by ADP 2 3-bisphosphoglyceride or GDP.
Pathway:	Metabolic intermediate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate from D-ribose 5-phosphate (route I): step 1/1.
Similarity:	Belongs to the ribose-phosphate pyrophosphokinase family. Ishijima. S. . (1997) Biochim. Biophys. Acta 1342 (1). 28-36.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer