Vergleich

[KO Validated] MTH1 Rabbit pAb (APR19920N)

ArtNr LBI-APR19920N-3
Hersteller Leading Biology
Menge 200 ul
Quantity options 50 ul 100 ul 200 ul
Kategorie
Format Liquid
Applikationen WB, IHC, CHIP
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Sequence MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Alias NUDT1, MTH1
Lieferbar
Manufacturer - Applications
WB (Homo sapiens)
IHC (Homo sapiens)
ChIP (Homo sapiens)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 17kDa/19kDa/20kDa/22kDaObserved MW: 18kDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality [KO Validated] MTH1 Rabbit pAb (APR19920N).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human MTH1 (NP_945192.1).
Cellular localization
Cytoplasm, Mitochondrion matrix, Nucleus
Summary
Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000IHC 1:50 - 1:200IP 1:20 - 1:50
Purification
Affinity purification
Positive Control
SW480, K562, 22RV1, THP-1, HepG2, SKOV3, 293T

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen