Vergleich

[KO Validated] EZH2/KMT6 Rabbit pAb (APR20428N)

ArtNr LBI-APR20428N-2
Hersteller Leading Biology
Menge 100 ul
Quantity options 50 ul 100 ul 200 ul
Kategorie
Format Liquid
Applikationen IP
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Sequence LERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELI
Alias ENX-1, ENX1, EZH1, EZH2b, KMT6, KMT6A, WVS, WVS2, EZH2, KMT6 / EZH2
Lieferbar
Manufacturer - Applications
IP (Homo sapiens)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 79kDa/81kDa/84kDa/85kDa/86kDaObserved MW: 105kDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality [KO Validated] EZH2/KMT6 Rabbit pAb (APR20428N).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human EZH2/KMT6 (NP_001190176.1).
Cellular localization
Nucleus
Summary
This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000IP 1:50 - 1:100
Purification
Affinity purification

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen