Vergleich

HDAC3 Rabbit pAb (APR24657N)

ArtNr LBI-APR24657N-3
Hersteller Leading Biology
Menge 200 ul
Quantity options 50 ul 100 ul 200 ul
Kategorie
Format Liquid
Applikationen WB, IF, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence TVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Alias HD3, RPD3, RPD3-2, HDAC3
Lieferbar
Manufacturer - Applications
WB (Homo sapiens)
IF (Homo sapiens)
ChIP (Homo sapiens)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 48kDa/49kDaObserved MW: 49KDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality HDAC3 Rabbit pAb (APR24657N).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 299-428 of human HDAC3 (NP_003874.2).
Cellular localization
Cytoplasm, Nucleus, cytosol
Summary
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000IHC 1:50 - 1:100IF 1:50 - 1:200IP 1:50 - 1:200ChIP 1:20 - 1:100
Purification
Affinity purification
Positive Control
HeLa, MCF7, NIH/3T3, C6

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen