Vergleich

NF-kB p65/RelA Rabbit pAb (APR24831N)

ArtNr LBI-APR24831N-2
Hersteller Leading Biology
Menge 100 ul
Quantity options 50 ul 100 ul 200 ul
Kategorie
Format Liquid
Applikationen WB, IF, IHC, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence RSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
Alias NFKB3, p65, NF-kB p65, RELA, CMCU
Lieferbar
Manufacturer - Applications
WB (RAW264.7, Mouse atherosclerosis arterial tissue, HCC827, U251, Mus musculus, Homo sapiens, Rattus norvegicus, Schisandra chinensis, Gallus gallus, Macaca mulatta, Sus scrofa, ?Cryptosporidium parvum, Alpinia katsumadai Hayata)
IF (Rat H9c2 cells, Mus musculus, Homo sapiens, Rattus norvegicus)
ChIP (Homo sapiens)
IHC (Mus musculus, Rattus norvegicus)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 58kDa/59kDa/60kDaObserved MW: 65KDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality NF-kB p65/RelA Rabbit pAb (APR24831N).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human NF-kB p65/RelA (NP_068810.3).
Cellular localization
Cytoplasm, Nucleus
Summary
NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000IHC 1:50 - 1:200IF 1:50 - 1:200
Purification
Affinity purification
Positive Control
HeLa, 293T, MCF7, Mouse lung, Mouse kidney, Rat lung, Rat kidney

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen