« Zurück
Startseite /
NOP58 Rabbit pAb (APR25590N)

NOP58 Rabbit pAb (APR25590N)

ArtNr	LBI-APR25590N
Hersteller	Leading Biology
Menge	50 ul
Quantity options	50 ul 100 ul 200 ul
Kategorie	Immunoprecipitation Immunofluorescence
Format	Liquid
Applikationen	IF, IP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Sequence	RMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED
Alias	NOP58, HSPC120, NOP5, NOP5/NOP58
Lieferbar
Manufacturer - Applications	IF (U-251MG) IP (U-251MG)
Manufacturer - Category	pAbs-N
Storage Conditions	Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Calculated MW: 59kDaObserved MW: 65KDa
Overview	We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality NOP58 Rabbit pAb (APR25590N).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 360-529 of human NOP58 (NP_057018.1).
Cellular localization	Nucleus, nucleolus, nucleoplasm
Summary	The protein encoded by this gene is a core component of box C/D small nucleolar ribonucleoproteins. Some box C/D small nucleolar RNAs (snoRNAs), such as U3, U8, and U14, are dependent upon the encoded protein for their synthesis. This protein is SUMOylated, which is necessary for high affinity binding to snoRNAs.
Manufacturer - Format	Liquid
Storage Buffer	Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution	WB 1:500 - 1:2000IF 1:50 - 1:200
Purification	Affinity purification
Positive Control	A375, NIH/3T3, K-562

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ul

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 24 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern