Vergleich

Rad18 Rabbit pAb (APR25782N)

ArtNr LBI-APR25782N-3
Hersteller Leading Biology
Menge 200 ul
Quantity options 50 ul 100 ul 200 ul
Kategorie
Format Liquid
Applikationen IF, IP
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Sequence INKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEI
Alias RAD18, RNF73
Lieferbar
Manufacturer - Applications
IP (Mus musculus)
IF (Mus musculus)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 56kDaObserved MW: 80kDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality Rad18 Rabbit pAb (APR25782N).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 216-495 of human Rad18 (NP_064550.3).
Cellular localization
Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center
Summary
The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000
Purification
Affinity purification
Positive Control
MCF7

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen