Vergleich

TEAD1 Rabbit pAb (APR26831N)

ArtNr LBI-APR26831N-3
Hersteller Leading Biology
Menge 200 ul
Quantity options 50 ul 100 ul 200 ul
Kategorie
Format Liquid
Applikationen WB, IF, IP, IHC, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK
Alias TEAD1, AA, NTEF-1, REF1, TCF-13, TCF13, TEAD-1, TEF-1
Lieferbar
Manufacturer - Applications
Co-IP (Homo sapiens)
WB (Mus musculus, Homo sapiens)
IF (Mus musculus)
ChIP (Mus musculus)
IHC (Homo sapiens)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 40kDa/47kDaObserved MW: 50kDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality TEAD1 Rabbit pAb (APR26831N).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2).
Cellular localization
Nucleus
Summary
This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000IF 1:50 - 1:200ChIP 1:50 - 1:200
Purification
Affinity purification
Positive Control
HeLa, MCF-7, Mouse kidney, Mouse heart, Rat kidney, Rat heart

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen