« Zurück
Startseite /
RECQL4 Rabbit pAb (APR26878N)

RECQL4 Rabbit pAb (APR26878N)

ArtNr	LBI-APR26878N-2
Hersteller	Leading Biology
Menge	100 ul
Quantity options	50 ul 100 ul 200 ul
Kategorie	Immunoprecipitation Immunofluorescence
Format	Liquid
Applikationen	IF, IP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Sequence	GAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGEPVQAQPPQPCSSPSNPRYHGLSPSSQARA
Alias	RECQL4, RECQ4
Lieferbar
Manufacturer - Applications	IP (Homo sapiens) IF (Homo sapiens)
Manufacturer - Category	pAbs-N
Storage Conditions	Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Calculated MW: 133kDaObserved MW: 140kDa
Overview	We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality RECQL4 Rabbit pAb (APR26878N).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 231-330 of human RECQL4 (NP_004251.3).
Cellular localization	Cytoplasm, Nucleus
Summary	The protein encoded by this gene is a DNA helicase that belongs to the RecQ helicase family. DNA helicases unwind double-stranded DNA into single-stranded DNAs and may modulate chromosome segregation. This gene is predominantly expressed in thymus and testis. Mutations in this gene are associated with Rothmund-Thomson, RAPADILINO and Baller-Gerold syndromes.
Manufacturer - Format	Liquid
Storage Buffer	Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution	WB 1:500 - 1:2000
Purification	Affinity purification
Positive Control	HeLa, Mouse thymus

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 24 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern