Vergleich

Muscarinic Toxin 3 Europäischer Partner

ArtNr ALO-M-140-1mg
Hersteller Alomone
Menge 1 mg
Quantity options 0.1 mg 0.25 mg 0.5 mg 1 mg 50 ug 5 mg
Kategorie
Typ Molecules
Format Lyophilized
Specific against other
Purity >99% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence LTCVTKNTIFGITTENCPAGQNLCFKRWHYVIPRYTEITRGCAATCPIPENYDSIHCCKTDKCNE-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Calcium imaging assay
Manufacturer - Category
Proteins
Manufacturer - Targets
M1, M4 muscarinic receptors, adrenoceptors
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
7379 Da
Manufacturer - Format
Lyophilized
Short description
An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors
Description
MT3, MT-3 - An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors

PH
7, 4
UNSPSC
12352202
Origin
Dendroaspis angusticeps (Eastern green mamba).
Modifications
Disulfide bonds between: Cys3-Cys24, Cys17-Cys42, Cys46-Cys57and Cys58-Cys63
Effective Concentration
100 nM - 1 μM
Activity
Muscarinic receptor 4 and adrenoceptor antagonist1-4.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Muscarinic toxins are isolated from the venom of the mamba species and are composed of 65 to 66 amino acid residues with four intramolecular disulfide bridges. One of these is muscarinic toxin 3 (MT-3) which was isolated from the green mamba (Dendroaspis augusticeps) and is composed of 65 amino acid residues1. A recent study investigated the interaction of MT3 with cloned receptors (mAChRs and adrenoceptors) expressed in insect cells by radioligand binding. MT3 appears to have a broad spectrum of targets showing high-affinity binding (IC50 = 1-10 nM) to M4 mAChR, α1A-, α1D- and α2A-adrenoceptors and lower affinity binding (IC50 > 25 nM) to α1B- and α2C-adrenoceptors and M1 mAChR2.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen