Vergleich

Calciseptine Europäischer Partner

ArtNr ALO-SPC-500-0.25mg
Hersteller Alomone
CAS-Nr. 178805-91-9
Menge 0.25 mg
Quantity options 0.25 mg 0.5 mg 10 mg 1 mg 5 mg 70 ug
Kategorie
Typ Molecules
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence RICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology
Manufacturer - Category
Proteins
Manufacturer - Targets
L-type Ca2+ channels
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
7036 Da
Manufacturer - Format
Lyophilized
Short description
A Specific Blocker of L-Type CaV Channels
Description
CaS, Calciseptin - A Specific Blocker of L-Type CaV Channels
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

A Specific Blocker of L-Type CaV Channels

PH
7, 4
UNSPSC
12352202
Origin
Dendroaspis polylepis polylepis (Black mamba)
Modifications
Disulfide bonds between: Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys58
Effective Concentration
500 nM
Activity
Calciseptine is a specific antagonist of L-type CaV channels1.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Calciseptine is a peptide toxin originally isolated from black mamba (Dendroaspis polylepsis) venom (1, 2). A three-finger toxin, calciseptine consists of 60 amino acids with 4 disulfide bridges (2). It is a specific L-type CaV channel blocker selective for CaV1.2 (3). Calciseptine binds to the shoulder of the CaV1.2 pore domain and traps the channel in a non-conductive conformation (4).Calciseptine blocks spontaneous or K+-induced contraction of cardiac and smooth muscle cells (2). However, in skeletal muscle, it increases L-type currents, modulating Ca2+ permeation (5). Using a patch clamp, calciseptine was shown to specifically block L-type CaV channel currents in neuronal cells in culture, with IC50 values of 15-500 nM (2). It was also shown to reduce the open probability and availability of the L-type channel in guinea pig portal vein smooth muscle cells, using outside-out patch clamping (6).CaV1.2 is one of 10 voltage-gated calcium channels (VGCCs), which are divided into three families based on the pore-forming α1 subunit (7); they were originally divided based on activation voltage current (8). Encoded by the CACNA1C gene, CaV1.2 consists of the three subunits α1, a2δ, and β. This channel is expressed by smooth and cardiac muscle, pancreas, neurons, and fibroblasts. It is involved in central nervous system function and neuroendocrine regulation, cardiac and smooth muscle contractibility, and multiple other physiological processes (9).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.25 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 08.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen